Rabbit Polyclonal Anti-PBK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PBK antibody: synthetic peptide directed towards the N terminal of human PBK. Synthetic peptide located within the following region: SLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQ |
Rabbit Polyclonal Antibody against PBK (C-term C300)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PBK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 286-317 amino acids from the C-terminal region of human PBK. |
PBK Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PBK |
SPK Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-322 of human SPK (NP_060962.2). |
| Modifications | Unmodified |
PBK Rabbit polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human PBK |
PBK Rabbit monoclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
