Antibodies

Jump to Filters
View as table Download
PCDHA3 (C-term) Rabbit Polyclonal Antibody
AP53197PU-N

USD 450.00

2 Weeks

PCDHA3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 780-808 amino acids from the C-terminal region of human PCDHA3
PCDHA3 Rabbit Polyclonal Antibody
TA339584

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCDHA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDHA3 antibody: synthetic peptide directed towards the N terminal of human PCDHA3. Synthetic peptide located within the following region: LFSWREDPGAQCLLLSLLLLAASEVGSGQLHYSVSEEAKHGTFVGRIAQD
PCDHA3 Rabbit Polyclonal Antibody
TA339585

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCDHA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PCDHA3 antibody is: synthetic peptide directed towards the middle region of Human PCDHA3. Synthetic peptide located within the following region: ATATVLVSLVESGQAPKASSQASAGATGPEAALVDVNVYLIVAICAVSSL