PCDHAC1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PCDHAC1 |
PCDHAC1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PCDHAC1 |
Rabbit polyclonal Anti-PCDHAC1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PCDHAC1 antibody: synthetic peptide directed towards the N terminal of human PCDHAC1. Synthetic peptide located within the following region: RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE |
Rabbit Polyclonal Anti-PCDHAC1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PCDHAC1 |