Antibodies

View as table Download

PCDHAC1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PCDHAC1

Rabbit polyclonal Anti-PCDHAC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDHAC1 antibody: synthetic peptide directed towards the N terminal of human PCDHAC1. Synthetic peptide located within the following region: RVQALDPDEGSNGEVQYSLSNSTQAELRHRFHVHPKSGEVQVAASLGPPE

Rabbit Polyclonal Anti-PCDHAC1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human PCDHAC1