Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Prostate Stem Cell Antigen antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Prostate Stem Cell Antigen antibody. |
Rabbit anti-PSCA Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PSCA |
Rabbit Polyclonal Anti-PSCA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PSCA antibody: synthetic peptide directed towards the C terminal of human PSCA. Synthetic peptide located within the following region: TVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILAL |
Rabbit Polyclonal PSCA Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the entire range of the target protein. |
PSCA Rabbit monoclonal antibody,clone OTIR2A2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PSCA Rabbit monoclonal antibody,clone OTIR2A2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PSCA