Rabbit Polyclonal Anti-DCNP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DCNP1 antibody was raised against an 18 amino acid peptide near the amino terminus of human DCNP1. |
Rabbit Polyclonal Anti-DCNP1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DCNP1 antibody was raised against an 18 amino acid peptide near the amino terminus of human DCNP1. |
Rabbit Polyclonal Anti-RAET1E Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | RAET1E antibody was raised against an 18 amino acid peptide near the center of human RAET1E. |
Rabbit Polyclonal Anti-RAET1E Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAET1E antibody is: synthetic peptide directed towards the C-terminal region of Human RAET1E. Synthetic peptide located within the following region: LEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDR |