Antibodies

Jump to Filters
View as table Download
RIN2 Rabbit Polyclonal Antibody
TA331221

USD 375.00

5 Days

Rabbit Polyclonal Anti-RIN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-RIN2 antibody is: synthetic peptide directed towards the N-terminal region of Human RIN2. Synthetic peptide located within the following region: RTDVNLENGLEPAETHSMVRHKDGGYSEEEDVKTCARDSGYDSLSNRLSI
RIN2 Rabbit Polyclonal Antibody
TA380930

USD 220.00

3 Weeks

RIN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 596-895 of human RIN2 (NP_061866.1).
Modifications Unmodified