Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-RNF138 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RNF138. |
Rabbit Polyclonal Anti-RNF138 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RNF138 Antibody: synthetic peptide directed towards the C terminal of human RNF138. Synthetic peptide located within the following region: LFQIVPVTCPICVSLPWGDPSQITRNFVSHLNQRHQFDYGEFVNLQLDEE |
RNF138 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of mouse RNF138 |
| Modifications | Unmodified |
Active filters
Target Symbol
- RNF138