Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-RAB34 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAB34. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-RAB34 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RAB34 antibody: synthetic peptide directed towards the C terminal of human RAB34. Synthetic peptide located within the following region: FFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTC |
RAB34 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human RAB34 (NP_114140.4). |
| Modifications | Unmodified |
Active filters
Target Symbol
- RAB34