Anti-RAD50 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
Anti-RAD50 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
Rabbit Polyclonal RAD50 Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit polyclonal anti-RAD50 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD50. |
Rabbit Polyclonal Antibody against RAD50 (zinc hook domain)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Human Rad50 zinc hook region (amino acids 628-787) expressed in E. coli. |
Rabbit Polyclonal Anti-RAD50 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAD50 Antibody is: synthetic peptide directed towards the N-terminal region of Human RAD50. Synthetic peptide located within the following region: SILGVRSFGIEDKDKQIITFFSPLTILVGPNGAGKTTIIECLKYICTGDF |
Rabbit Polyclonal Rad50 Antibody
Applications | WB |
Reactivities | Human, Mouse, Hamster |
Conjugation | Unconjugated |
Immunogen | C-terminal mouse RAD50 (604 amino acids). [UniProt# P70388] |
Anti-RAD50 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
RAD50 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human RAD50 |
Rad50 Rabbit polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human Rad50 |
Modifications | Unmodified |
Rad50 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human Rad50 |