Antibodies

View as table Download

RAP1GAP rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAP1GAP

Rabbit polyclonal anti-RAP1GDS1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RAP1GDS1.

Rabbit polyclonal Anti-RAP1GAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAP1GAP antibody: synthetic peptide directed towards the middle region of human RAP1GAP. Synthetic peptide located within the following region: IENIQEVQEKRESPPAGQKTPDSGHVSQEPKSENSSTQSSPEMPTTKNRA

Rabbit polyclonal Anti-RAP1GAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAP1GAP antibody: synthetic peptide directed towards the middle region of human RAP1GAP. Synthetic peptide located within the following region: TWLEDSVSTTSGGSSPGPSRSPHPDAGKLGDPACPEIKIQLEASEQHMPQ

Mouse monoclonal Anti-RAP1 Clone RAP1 4C8/1

Applications IF
Reactivities Human, Mouse
Conjugation Unconjugated

RAP1GAP Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human RAP1GAP

RAP1GAP rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RAP1GAP

Rap1GAP Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 508-727 of human Rap1GAP (NP_001139130.1).
Modifications Unmodified

RAP1GAP Rabbit monoclonal Antibody

Applications IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated