USD 480.00
2 Weeks
RAGEF2 (RAPGEF6) (1012-1111) mouse monoclonal antibody, clone 2C5, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
USD 480.00
2 Weeks
RAGEF2 (RAPGEF6) (1012-1111) mouse monoclonal antibody, clone 2C5, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Anti-RAPGEF6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RAPGEF6 antibody is: synthetic peptide directed towards the N-terminal region of Human RAPGEF6. Synthetic peptide located within the following region: GSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVENAKDNEDSILQREIPA |
RAPGEF6 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 145-240 of human RAPGEF6 (NP_001157858). |