Antibodies

Jump to Filters
View as table Download
RASL10A Rabbit Polyclonal Antibody
TA340116

USD 375.00

5 Days

Rabbit Polyclonal Anti-RASL10A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RASL10A antibody: synthetic peptide directed towards the N terminal of human RASL10A. Synthetic peptide located within the following region: PTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPGGPEEWPDAKDWSLQ
Rasl10a Rabbit Polyclonal Antibody
TA357023

USD 360.00

5 Days

Rasl10a Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated