Antibodies

Jump to Filters
View as table Download
RBMS3 Rabbit Polyclonal Antibody
TA345701

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBMS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBMS3 antibody: synthetic peptide directed towards the middle region of human RBMS3. Synthetic peptide located within the following region: TYIPQYTPVPPTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEH
RBMS3 Rabbit Polyclonal Antibody
TA345702

USD 475.00

5 Days

Rabbit Polyclonal Anti-RBMS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBMS3 antibody: synthetic peptide directed towards the middle region of human RBMS3. Synthetic peptide located within the following region: PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK
RBMS3 Rabbit Polyclonal Antibody
TA345703

USD 410.00

5 Days

Rabbit Polyclonal Anti-RBMS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBMS3 antibody: synthetic peptide directed towards the N terminal of human RBMS3. Synthetic peptide located within the following region: GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA
RBMS3 Rabbit Polyclonal Antibody
TA345704

USD 410.00

5 Days

Rabbit Polyclonal Anti-RBMS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RBMS3 antibody: synthetic peptide directed towards the C terminal of human RBMS3. Synthetic peptide located within the following region: TAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSKP
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF811596

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RBMS3 mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI8A9]
CF811599

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RBMS3 mouse monoclonal antibody,clone OTI8A9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI8E5]
CF811600

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RBMS3 mouse monoclonal antibody,clone OTI8E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Rabbit Polyclonal Antibody
TA323498

USD 345.00

In Stock

Anti-RBMS3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 425-437 amino acids of Human RNA binding motif, single stranded interacting protein 3
RBMS3 Rabbit Polyclonal Antibody
TA380792

USD 220.00

3 Weeks

RBMS3 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 334-433 of human RBMS3 (NP_001171183.1).
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA811596

USD 379.00

In Stock

RBMS3 mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D11]
TA811596AM

USD 420.00

4 Weeks

RBMS3 mouse monoclonal antibody,clone OTI2D11, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
RBMS3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]
TA811596BM

USD 420.00

4 Weeks

RBMS3 mouse monoclonal antibody,clone OTI2D11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA811596S

USD 159.00

2 Days

RBMS3 mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI8A9]
TA811599

USD 379.00

In Stock

RBMS3 mouse monoclonal antibody,clone OTI8A9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI8A9]
TA811599S

USD 159.00

2 Days

RBMS3 mouse monoclonal antibody,clone OTI8A9

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI8E5]
TA811600

USD 379.00

In Stock

RBMS3 mouse monoclonal antibody,clone OTI8E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
RBMS3 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8E5]
TA811600AM

USD 420.00

4 Weeks

RBMS3 mouse monoclonal antibody,clone OTI8E5, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
RBMS3 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8E5]
TA811600BM

USD 420.00

4 Weeks

RBMS3 mouse monoclonal antibody,clone OTI8E5, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
RBMS3 Mouse Monoclonal Antibody [Clone ID: OTI8E5]
TA811600S

USD 159.00

2 Days

RBMS3 mouse monoclonal antibody,clone OTI8E5

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated