Antibodies

Jump to Filters
View as table Download
Calcipressin 3 (RCAN3) Rabbit Polyclonal Antibody
TA372162

USD 380.00

4 Weeks

RCAN3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RCAN3
Calcipressin 3 (RCAN3) Rabbit Polyclonal Antibody
TA343794

USD 475.00

5 Days

Rabbit Polyclonal Anti-RCAN3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RCAN3 antibody: synthetic peptide directed towards the middle region of human RCAN3. Synthetic peptide located within the following region: PGEKYELHAGTESTPSVVVHVCESETEEEEETKNPKQKIAQTRRPDPPTA
Calcipressin 3 (RCAN3) Mouse Monoclonal Antibody [Clone ID: OTI1B2]
CF505496

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) RCAN3 mouse monoclonal antibody, clone OTI1B2 (formerly 1B2)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Calcipressin 3 (RCAN3) Rabbit Polyclonal Antibody
TA362223

USD 360.00

5 Days

RCAN3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human RCAN3
RCAN3 Rabbit Polyclonal Antibody
TA367927

USD 380.00

4 Weeks

RCAN3 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human RCAN3