Antibodies

Jump to Filters
View as table Download
RPL27A Rabbit Polyclonal Antibody
TA314465

USD 345.00

In Stock

Rabbit polyclonal anti-RPL27A antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human RPL27A.
RPL27A (C-term) Rabbit Polyclonal Antibody
AP53714PU-N

USD 450.00

2 Weeks

RPL27A (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Hamster, Human
Immunogen KLH conjugated synthetic peptide between 113-142 amino acids from the C-terminal region of Human RPL27A.
RPL27A Rabbit Polyclonal Antibody
TA338354

USD 375.00

5 Days

Rabbit Polyclonal Anti-RPL27A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RPL27A antibody is: synthetic peptide directed towards the C-terminal region of Human RPL27A. Synthetic peptide located within the following region: GAAPIIDVVRSGYYKVLGKGKLPKQPVIVKAKFFSRRAEEKIKSVGGACV
RPL27A Rabbit Polyclonal Antibody
TA358921

USD 360.00

5 Days

RPL27A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human RPL27A