Rabbit Polyclonal Anti-RTDR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the N terminal of human RTDR1. Synthetic peptide located within the following region: MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL |
Rabbit Polyclonal Anti-RTDR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RTDR1 antibody: synthetic peptide directed towards the middle region of human RTDR1. Synthetic peptide located within the following region: IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRA |
RSPH14 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human RSPH14 |
RSPH14 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-348 of human RSPH14 (NP_055248.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
