Rabbit Polyclonal Anti-SAMD8 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SAMD8 antibody: synthetic peptide directed towards the middle region of human SAMD8. Synthetic peptide located within the following region: MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL |
SAMD8 rabbit polyclonal antibody, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
| Immunogen | Full-length recombinant sphingomyelin synthase r fusion protein. |
SAMD8 (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 45-75 amino acids from the N-terminal region of Human SAMD8 |
Germany
Japan
United Kingdom
China