Germany
Japan
United Kingdom
China
USD 340.00
2 Weeks
Shwachman Bodian Diamond syndrome (SBDS) (1-250) mouse monoclonal antibody, clone AT1E8, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Antibodies
View as table Download
USD 230.00
2 Weeks
Shwachman Bodian Diamond syndrome (SBDS) (1-250) mouse monoclonal antibody, clone AT1E8, Purified
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Anti-SBDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SBDS antibody: synthetic peptide directed towards the N terminal of human SBDS. Synthetic peptide located within the following region: LQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKER |
Rabbit Polyclonal Anti-SBDS Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SBDS antibody: synthetic peptide directed towards the C terminal of human SBDS. Synthetic peptide located within the following region: DYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE |
SBDS rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SBDS |
SBDS rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SBDS |
SBDS Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human SBDS (NP_057122.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SBDS