Rabbit Polyclonal Anti-SEPHS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SEPHS2 antibody is: synthetic peptide directed towards the C-terminal region of Human SEPHS2. Synthetic peptide located within the following region: AATDITGFGILGHSQNLAKQQRNEVSFVIHNLPIIAKMAAVSKASGRFGL |
Rabbit polyclonal Selenophosphate Synthetase 2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a full-length recombinant protein corresponding to mouse SPS2. |
SEPHS2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SEPHS2 |
SEPHS2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SEPHS2 |
Germany
Japan
United Kingdom
China
