Antibodies

Jump to Filters
View as table Download
SEZ6 Rabbit Polyclonal Antibody
TA337738

USD 375.00

5 Days

Rabbit Polyclonal Anti-SEZ6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SEZ6 antibody is: synthetic peptide directed towards the C-terminal region of Human SEZ6. Synthetic peptide located within the following region: RAPKCLLEQLKPCHGLSAPENGARSPEKQLHPAGATIHFSCAPGYVLKGQ