Rabbit Polyclonal Anti-SHF Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-SHF antibody is: synthetic peptide directed towards the C-terminal region of Human SHF. Synthetic peptide located within the following region: ADERISGPPASSDRLAILEDYADPFDVQETGEGSAGASGAPEKVPENDGY |
Rabbit Polyclonal Anti-SHF Antibody
| Reactivities | Human |
| Immunogen | The immunogen for anti-SHF antibody is: synthetic peptide directed towards the middle region of Human SHF. Synthetic peptide located within the following region: QPLPLYDTPYEPEEDGATPEGEGAPWPRESRLPEDDERPPEEYDQPWEWK |
Germany
Japan
United Kingdom
China