Antibodies

Jump to Filters
View as table Download
Skor1 Rabbit Polyclonal Antibody
TA329597

USD 375.00

5 Days

Rabbit polyclonal anti-Lbxcor1 antibody

Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Lbxcor1 antibody: synthetic peptide directed towards the middle region of mouse Lbxcor1. Synthetic peptide located within the following region: EPDKEDNHSTTADDLETRKSFSDQRSVSQPSPANTDRGEDGLTLDVTGTQ
SKOR1 Rabbit Polyclonal Antibody
TA356869

USD 360.00

5 Days

SKOR1 Antibody - N-terminal region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the n terminal region of human SKOR1