Antibodies

Jump to Filters
View as table Download
SLC48A1 Rabbit Polyclonal Antibody
TA344145

USD 475.00

5 Days

Rabbit Polyclonal Anti-FLJ20489 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FLJ20489 antibody: synthetic peptide directed towards the C terminal of human FLJ20489. Synthetic peptide located within the following region: LISGDSPASAFQSAGIIGVSHRARPGSVFLARSEESLYLRPGQQSQEVKV