Germany
Japan
United Kingdom
China
USD 410.00
2 Weeks
Mouse Monoclonal anti-SLC5A5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Antibodies
View as table Download
USD 410.00
In Stock
Mouse monoclonal Sodium-Iodide Symporter Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-SLC5A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A5 Antibody: synthetic peptide directed towards the N terminal of human SLC5A5. Synthetic peptide located within the following region: TAVGGMKAVVWTDVFQVVVMLSGFWVVLARGVMLVGGPRQVLTLAQNHSR |
Rabbit Polyclonal Anti-SLC5A5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SLC5A5 Antibody: synthetic peptide directed towards the middle region of human SLC5A5. Synthetic peptide located within the following region: PSEQTMRVLPSSAARCVALSVNASGLLDPALLPANDSSRAPSSGMDASRP |
Anti-SLC5A5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human solute carrier family 5 (sodium iodide symporter), member 5 |
Anti-SLC5A5 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of Human solute carrier family 5 (sodium iodide symporter), member 5 |
Active filters
Target Symbol
- SLC5A5