Rabbit Polyclonal Anti-SLC5A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC5A9 |
Rabbit Polyclonal Anti-SLC5A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SLC5A9 |
SGLT4 / SLC5A9 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Gibbon, Marmoset, Bovine (89%); Mouse (83%). |
SGLT4 / SLC5A9 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset (100%); Gibbon, Mouse, Bat, Bovine, Hamster, Elephant (93%); Turkey, Chicken (80%). |
SGLT4 / SLC5A9 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human SLC5A9. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey, Marmoset, Dog (94%); Bat, Horse, Pig, Opossum (88%); Elephant, Panda (82%). |
SGLT4 / SLC5A9 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Gorilla, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | SLC5A9 / SGLT4 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC5A9. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Elephant, Dog (94%); Galago, Panda, Bovine, Horse, Pig (88%); Mouse, Bat (82%). |
Rabbit Polyclonal Anti-SLC5A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SLC5A9 Antibody: synthetic peptide directed towards the N terminal of human SLC5A9. Synthetic peptide located within the following region: MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA |
SLC5A9 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-320 of human SLC5A9 (NP_001011547.2). |
Modifications | Unmodified |