Antibodies

Jump to Filters
View as table Download
SLITRK1 Rabbit Polyclonal Antibody
TA306521

USD 430.00

5 Days

Rabbit Polyclonal Slitrk1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Slitrk1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human Slitrk1.
SLITRK1 (C-term) Rabbit Polyclonal Antibody
AP22669PU-N

USD 525.00

2 Weeks

SLITRK1 (C-term) rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SLITRK1 antibody was raised against 16 amino acid peptide from near the carboxy terminus of human Slitrk1
SLITRK1 Rabbit Polyclonal Antibody
TA306522

USD 430.00

5 Days

Rabbit Polyclonal Slitrk1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Slitrk1 antibody was raised against a 18 amino acid peptide from near the center of human Slitrk1.
SLITRK1 Rabbit Polyclonal Antibody
TA336791

USD 424.00

5 Days

Rabbit Polyclonal SLITRK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Slitrk1 protein (within residues 250-400). [Swiss-Prot Q96PX8]
SLITRK1 Rabbit Polyclonal Antibody
TA342070

USD 375.00

5 Days

Rabbit Polyclonal Anti-SLITRK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLITRK1 antibody: synthetic peptide directed towards the N terminal of human SLITRK1. Synthetic peptide located within the following region: CDLLSLKEWLENIPKNALIGRVVCEAPTRLQGKDLNETTEQDLCPLKNRV
Slitrk1 Rabbit Polyclonal Antibody
TA342071

USD 375.00

5 Days

Rabbit Polyclonal Anti-Slitrk1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Slitrk1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Slitrk1. Synthetic peptide located within the following region: LKCETPVNFFRKDFMLLSNEEICPQLYARISPTLTSHSKNSTGLAETGTH