Rabbit Polyclonal antibody to SNTB2 (syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 174 and 540 of SNTB2 (Uniprot ID#Q13425) |
Syntrophin (SNTB2) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the central region (between 216-245aa) of human Syntrophin-3 / SNTB2. |
Rabbit Polyclonal Anti-SNTB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SNTB2 antibody is: synthetic peptide directed towards the N-terminal region of Human SNTB2. Synthetic peptide located within the following region: AGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQ |
SNTB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
SNTB2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SNTB2 |
SNTB2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SNTB2. |
Germany
Japan
United Kingdom
China
