Rabbit Polyclonal Anti-SPAG16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPAG16 antibody is: synthetic peptide directed towards the N-terminal region of Human SPAG16. Synthetic peptide located within the following region: ISGLQETLKKLQRGHSYHGPQIKVDHSREKENAPEGPTQKGLREAREQNK |
Rabbit Polyclonal Anti-SPAG16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPAG16 antibody is: synthetic peptide directed towards the N-terminal region of Human SPAG16. Synthetic peptide located within the following region: LENENKNLKKDLKHYKQAADKAREDLLKIQKERDFHRMHHKRIVQEKNKL |
SPAG16 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human SPAG16 (NP_001020607.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China