SPEM1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 114-144 amino acids from the Central region of Human SPEM1 |
SPEM1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 114-144 amino acids from the Central region of Human SPEM1 |
Rabbit Polyclonal Anti-SPEM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-SPEM1 Antibody is: synthetic peptide directed towards the N-terminal region of Human SPEM1. Synthetic peptide located within the following region: KSSLLRKQTQPPKKQSSPAVHLRCTMDPVMMTVSPPPAHRHRRRGSPTRC |