Goat Anti-SPINT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PSAPRRQDSEDH, from the internal region of the protein sequence according to NP_066925.1; NP_001159575.1. |
Goat Anti-SPINT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PSAPRRQDSEDH, from the internal region of the protein sequence according to NP_066925.1; NP_001159575.1. |
Rabbit Polyclonal Anti-SPINT2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SPINT2 antibody: synthetic peptide directed towards the middle region of human SPINT2. Synthetic peptide located within the following region: MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLGASMVYLIRVARRNQE |
SPINT2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human SPIT2 |
SPINT2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SPINT2 |
SPINT2 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SPINT2 |
SPINT2 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 28-197 of human SPINT2 (NP_066925.1). |
Modifications | Unmodified |