Germany
Japan
United Kingdom
China
Goat Polyclonal Anti-SPO11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_036576.1; NP_937998.1 (NTYATKRDIYYTDSQ) |
Antibodies
View as table Download
Rabbit Polyclonal Anti-SPO11 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPO11 antibody: synthetic peptide directed towards the N terminal of human SPO11. Synthetic peptide located within the following region: KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC |
SPO11 Antibody - middle region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SPO11 |
Active filters
Target Symbol
- SPO11