Rabbit Polyclonal Anti-SPRR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPRR3 antibody: synthetic peptide directed towards the middle region of human SPRR3. Synthetic peptide located within the following region: PTTKEPCHSKVPQPGNTKIPEPGCTKVPEPGCTKVPEPGCTKVPEPGCTK |
Rabbit Polyclonal Anti-SPRR3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPRR3 antibody: synthetic peptide directed towards the middle region of human SPRR3. Synthetic peptide located within the following region: DQGFIKFPEPGAIKVPEQGYTKVPVPGYTKLPEPCPSTVTPGPAQQKTKQ |
SPRR3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 100-129aa) of human SPRR3 / Cornifin beta |
SPRR3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-70 of human SPRR3 (NP_005407.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China