Rabbit Polyclonal Anti-SPRTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPRTN Antibody is: synthetic peptide directed towards the middle region of Human SPRTN. Synthetic peptide located within the following region: ATNREPSAHDYWWAEHQKTCGGTYIKIKEPENYSKKGKGKAKLGKEPVLA |
Rabbit Polyclonal Anti-SPRTN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPRTN Antibody is: synthetic peptide directed towards the C-terminal region of Human SPRTN. Synthetic peptide located within the following region: QIKSSGNDPKYSTTTAQNSSSSSSQSKMVNCPVCQNEVLESQINEHLDWC |
SPRTN rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SPRTN |
SPRTN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human SPRTN (NP_001010984.1). |
| Modifications | Unmodified |
SPRTN Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human SPRTN (NP_001010984.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
