Rabbit Polyclonal Anti-SRGAP3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRGAP3 antibody is: synthetic peptide directed towards the N-terminal region of Human SRGAP3. Synthetic peptide located within the following region: SSVKKIEKMKEKRQAKYSENKLKCTKARNDYLLNLAATNAAISKYYIHDV |
Rabbit Polyclonal Anti-SRGAP3 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SRGAP3 |
SRGAP3 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human SRGAP3 |
SRGAP3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SRGAP3 |
Germany
Japan
United Kingdom
China