Antibodies

View as table Download

Rabbit Polyclonal Anti-STARD8 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STARD8

Rabbit Polyclonal Anti-STARD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STARD8 antibody: synthetic peptide directed towards the N terminal of human STARD8. Synthetic peptide located within the following region: KKRHRNRSFLKHLESLRRKEKSGSQQAEPKHSPATSEKVSKASSFRSCRG

Rabbit Polyclonal Anti-STARD8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STARD8 antibody: synthetic peptide directed towards the N terminal of human STARD8. Synthetic peptide located within the following region: SSDRPLLSPTQGQEGPQDKAKKRHRNRSFLKHLESLRRKEKSGSQQAEPK

STARD8 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human STARD8