Antibodies

Jump to Filters
View as table Download
STK31 Rabbit Polyclonal Antibody
TA339776

USD 375.00

5 Days

Rabbit Polyclonal Anti-STK31 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STK31 antibody: synthetic peptide directed towards the N terminal of human STK31. Synthetic peptide located within the following region: SPIPLWGHRSNQSTFSRPKGHLSEKMTLDLKDENDAGNLITFPKESLAVG
STK31 Rabbit Polyclonal Antibody
TA382133

USD 220.00

3 Weeks

STK31 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 890-1019 of human STK31 (NP_113602.2).
Modifications Unmodified