Antibodies

View as table Download

Rabbit Polyclonal Anti-STYXL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STYXL1 antibody: synthetic peptide directed towards the middle region of human STYXL1. Synthetic peptide located within the following region: FLRTQKIIWMPQELDAFQPYPIEIVPGKVFVGNFSQACDPKIQKDLKIKA

STYXL1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human STYXL1 (NP_001304714.1).
Modifications Unmodified