Rabbit Polyclonal Anti-SURF6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SURF6 antibody: synthetic peptide directed towards the middle region of human SURF6. Synthetic peptide located within the following region: EPREPPGLIFNKVEVSEDEPASKAQRRKEKRQRVKGNLTPLTGRNYRQLL |
Rabbit Polyclonal Anti-SURF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SURF6 antibody: synthetic peptide directed towards the N terminal of human SURF6. Synthetic peptide located within the following region: ICSHSAPEQQARTRAGKTQGSETAGPPKKKRKKTQKKFRKREEKAAEHKA |
SURF6 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SURF6 |
Germany
Japan
United Kingdom
China
