Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SYNCRIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNCRIP antibody: synthetic peptide directed towards the N terminal of human SYNCRIP. Synthetic peptide located within the following region: MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG |
Rabbit Polyclonal Anti-SYNCRIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SYNCRIP antibody: synthetic peptide directed towards the middle region of human SYNCRIP. Synthetic peptide located within the following region: IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG |
Rabbit Polyclonal Anti-SYNCRIP Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SYNCRIP |
SYNCRIP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human SYNCRIP |
hnRNP Q/SYNCRIP Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human hnRNP Q /hnRNP Q/SYNCRIP (NP_001153146.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SYNCRIP