Rabbit polyclonal antibody to SHC4 (SHC (Src homology 2 domain containing) family, member 4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 352 and 630 of SHC4 (Uniprot ID#Q6S5L8) |
Rabbit Polyclonal Anti-SHC4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SHC4 antibody is: synthetic peptide directed towards the N-terminal region of Human SHC4. Synthetic peptide located within the following region: NPATLLSLKNFCLGTKEVPRLKLQESRDPGSSGPSSPETSLSRSGTAPPP |
SHC4 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human SHC4 |
Germany
Japan
United Kingdom
China
