Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SIN3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIN3B antibody: synthetic peptide directed towards the middle region of human SIN3B. Synthetic peptide located within the following region: NDTKALRSKSLLNEIESVYDEHQEQHSEGRSAPSSEPHLIFVYEDRQILE |
Rabbit Polyclonal Anti-SIN3B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIN3B antibody: synthetic peptide directed towards the middle region of human SIN3B. Synthetic peptide located within the following region: LVSDDVCLKVVELYLNEKKRGAAGGNLSSRCVRAARETSYQWKAERCMAD |
Rabbit Polyclonal Anti-SIN3B Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIN3B antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: NIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYV |
Rabbit Polyclonal Anti-Sin3b Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Sin3b antibody: synthetic peptide directed towards the N terminal of mouse Sin3b. Synthetic peptide located within the following region: LSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPV |
SIN3B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SIN3B (NP_056075.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SIN3B