Rabbit polyclonal anti-SLC30A9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A9. |
Rabbit polyclonal anti-SLC30A9 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A9. |
Rabbit Polyclonal anti-SLC30A9 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9. Synthetic peptide located within the following region: LKQEPLQVRVKAVLKKREYGSKYTQNNFITGVRAINEFCLKSSDLEQLR |
Rabbit polyclonal anti-SLC30A9 antibody
Applications | WB |
Reactivities | Human Mouse Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SLC30A9. |
Rabbit Polyclonal Anti-SLC30A9 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SLC30A9 antibody: synthetic peptide directed towards the N terminal of human SLC30A9. Synthetic peptide located within the following region: LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV |