Germany
Japan
United Kingdom
China
Antibodies
View as table Download
SMC2 (C-term) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide selected from the C-terminal region of human SMC2. |
Goat Anti-CAPE Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SKAKPPKGAHVEV, from the C Terminus of the protein sequence according to NP_006435.2. |
Rabbit Polyclonal Anti-SMC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMC2 antibody: synthetic peptide directed towards the N terminal of human SMC2. Synthetic peptide located within the following region: ISNLSQVRASNLQDLVYKNGQAGITKASVSITFDNSDKKQSPLGFEVHDE |
Rabbit Polyclonal Anti-SMC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SMC2 antibody: synthetic peptide directed towards the middle region of human SMC2. Synthetic peptide located within the following region: ATLAGQMMACKNDISKAQTEAKQAQMKLKHAQQELKNKQAEVKKMDSGYR |
Rabbit Polyclonal Anti-SMC2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human SMC2 |
SMC2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 700-900 of human SMC2 (NP_006435.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SMC2