Antibodies

Jump to Filters
View as table Download
SNX33 Rabbit Polyclonal Antibody
TA331298

USD 375.00

5 Days

Rabbit Polyclonal Anti-SNX33 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SNX33 antibody is: synthetic peptide directed towards the C-terminal region of Human SNX33. Synthetic peptide located within the following region: FPDIIHLQKGAFAKVKESQRMSDEGRMVQDEADGIRRRCRVVGFALQAEM
SNX33 Rabbit Polyclonal Antibody
TA351740

USD 345.00

In Stock

Rabbit Polyclonal Anti-SNX33 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SNX33
SNX33 Rabbit Polyclonal Antibody
TA367282

USD 380.00

4 Weeks

SNX33 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human SNX33