Antibodies

Jump to Filters
View as table Download
SPACA1 (N-term) Rabbit Polyclonal Antibody
AP53788PU-N

USD 450.00

2 Weeks

SPACA1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 46-74 amino acids from the N-terminal region of Human SACA1
SPACA1 Rabbit Polyclonal Antibody
TA339572

USD 375.00

5 Days

Rabbit Polyclonal Anti-SPACA1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SPACA1 antibody: synthetic peptide directed towards the N terminal of human SPACA1. Synthetic peptide located within the following region: TENNDSETAENYAPPETEDVSNRNVVKEVEFGMCTVTCGIGVREVILTNG
SPACA1 Rabbit Polyclonal Antibody
TA366474

USD 380.00

4 Weeks

SPACA1 rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SPACA1
SPACA1 Rabbit Polyclonal Antibody
TA370820

USD 380.00

4 Weeks

SPACA1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human SPACA1