Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-SPON2 antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SPON2. |
Antibodies
View as table Download
Goat Anti-SPON2 (301-315) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RTRYVRVQPANNGSP, from the internal region (near C Terminus) of the protein sequence according to NP_036577.1. |
Rabbit Polyclonal Anti-SPON2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPON2 antibody: synthetic peptide directed towards the N terminal of human SPON2. Synthetic peptide located within the following region: CSARAPAKYSITFTGKWSQTAFPKQYPLFRPPAQWSSLLGAAHSSDYSMW |
Rabbit Polyclonal Anti-SPON2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SPON2 antibody: synthetic peptide directed towards the middle region of human SPON2. Synthetic peptide located within the following region: GTDSGFTFSSPNFATIPQDTVTEITSSSPSHPANSFYYPRLKALPPIARV |
SPON2 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 27-150 of human SPON2 (NP_036577.1). |
| Modifications | Unmodified |
SPON2 Rabbit monoclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SPON2