Rabbit polyclonal anti-STAC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human STAC2. |
Rabbit polyclonal anti-STAC2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human STAC2. |
Rabbit Polyclonal Anti-STAC2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-STAC2 antibody is: synthetic peptide directed towards the N-terminal region of Human STAC2. Synthetic peptide located within the following region: TEMSEKENEPDDAATHSPPGTVSALQETKLQRFKRSLSLKTILRSKSLEN |