TBCEL mouse monoclonal antibody, clone AT1B10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
TBCEL mouse monoclonal antibody, clone AT1B10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
TBCEL mouse monoclonal antibody, clone AT1B10, Purified
Applications | ELISA, FC, IF, WB |
Reactivities | Human |
TBCEL (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 384-413 amino acids from the C-terminal region of human TBCEL |
Rabbit Polyclonal Anti-TBCEL Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TBCEL antibody is: synthetic peptide directed towards the C-terminal region of Human TBCEL. Synthetic peptide located within the following region: ISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARL |
Carrier-free (BSA/glycerol-free) TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), Biotinylated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3), HRP conjugated
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)
Applications | FC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |