Antibodies

View as table Download

TBCEL mouse monoclonal antibody, clone AT1B10, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

TBCEL mouse monoclonal antibody, clone AT1B10, Purified

Applications ELISA, FC, IF, WB
Reactivities Human

TBCEL (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 384-413 amino acids from the C-terminal region of human TBCEL

Rabbit Polyclonal Anti-TBCEL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TBCEL antibody is: synthetic peptide directed towards the C-terminal region of Human TBCEL. Synthetic peptide located within the following region: ISLHKSGLQSWEDIDKLNSFPKLEEVRLLGIPLLQPYTTEERRKLVIARL

Carrier-free (BSA/glycerol-free) TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TBCEL mouse monoclonal antibody, clone OTI3H3 (formerly 3H3)

Applications FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

TBCEL mouse monoclonal antibody, clone OTI2A9 (formerly 2A9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated