Rabbit Polyclonal Anti-TEKT3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Tekt3 antibody is: synthetic peptide directed towards the N-terminal region of Mouse Tekt3. Synthetic peptide located within the following region: NSSRHNSERLRVDTSRLIQDKYQQIRKTQAHSTQNLGERVNDLAFWKSEI |
Rabbit Polyclonal Anti-TEKT3 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Tekt3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MLPFVSNRTTLFTRYTPDDWYRSTLVGFQESNCSRHNSERLRVDTSRLIQ |
Anti-TEKT3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 300 amino acids of human tektin 3 |
Germany
Japan
United Kingdom
China
