Rabbit Polyclonal Anti-THAP6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THAP6 antibody: synthetic peptide directed towards the middle region of human THAP6. Synthetic peptide located within the following region: FDRSAPNIKLKPGVIPSIFDSPYHLQGKREKLHCRKNFTLKTVPATNYNH |
Carrier-free (BSA/glycerol-free) THAP6 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) THAP6 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) THAP6 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
5 Days
THAP6 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
THAP6 mouse monoclonal antibody,clone 3A8, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
THAP6 mouse monoclonal antibody,clone 3A8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
THAP6 mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
THAP6 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
THAP6 mouse monoclonal antibody,clone 4C2, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
THAP6 mouse monoclonal antibody,clone 4C2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
THAP6 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
THAP6 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
THAP6 mouse monoclonal antibody,clone 4D4, Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
THAP6 mouse monoclonal antibody,clone 4D4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
THAP6 mouse monoclonal antibody, clone OTI4D4 (formerly 4D4)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
